Overview

  • Product name
  • Description
    Rabbit polyclonal to MARCH6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Dog, Pig, Xenopus laevis, Zebrafish
  • Immunogen

    Synthetic peptide within Human MARCH6 aa 450-500. The exact sequence is proprietary. NP_005876.2.
    Sequence:

    VLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSIVLLMLWLPI R


    Database link: O60337

  • Positive control
    • 293T whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab183533 was affinity purified using an epitope specific to MARCH6 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab183533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 103 kDa.

Target

  • Relevance
    MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi pass membrane protein.
  • Database links
  • Alternative names
    • DOA10 antibody
    • Doa10 homolog antibody
    • E3 ubiquitin protein ligase MARCH6 antibody
    • KIAA0597 antibody
    • MARCH 6 antibody
    • MARCH VI antibody
    • MARCHVI antibody
    • Membrane associated RING CH protein VI antibody
    • Membrane associated ring finger (C3HC4) 6 antibody
    • Membrane associated RING finger protein 6 antibody
    • Protein TEB 4 antibody
    • Protein TEB4 antibody
    • RING finger protein 176 antibody
    • RNF 176 antibody
    • RNF176 antibody
    • TEB 4 antibody
    • TEB4 antibody
    see all

Images

  • Detection of MARCH6 by Western Blot of Immunoprecipitate.
    ab183533 at 1µg/ml labeling MARCH6 in 293T whole cell lysate immunoprecipitated using ab183533 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Detection: Chemiluminescence with exposure time of 30 seconds.

  • Anti-MARCH6 antibody (ab183533) at 1 µg/ml + 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 103 kDa


    Exposure time: 30 seconds

References

ab183533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up