Anti-MCM7/PRL antibody - BSA and Azide free (ab179904)
Key features and details
- Rabbit polyclonal to MCM7/PRL
- Suitable for: WB, ICC/IF, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-MCM7/PRL antibody - BSA and Azide free
See all MCM7/PRL primary antibodies -
Description
Rabbit polyclonal to MCM7/PRL -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment (His-tag) corresponding to Human MCM7/PRL aa 562-719 (C terminal).
Sequence:YIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILR LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI FATVRELVS GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
Database link: P33993 -
Positive control
- Human HeLa, SiHa, C33A, WI38 cell extracts; Mouse NIH 3T3 cell extract.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab179904 is filter-sterilised. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab179904 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/1000 - 1/5000. Predicted molecular weight: 81 kDa.
|
ICC/IF |
1/200 - 1/1000.
|
|
IP |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/1000 - 1/5000. Predicted molecular weight: 81 kDa. |
ICC/IF
1/200 - 1/1000. |
IP
Use at an assay dependent concentration. |
Target
-
Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage. -
Sequence similarities
Belongs to the MCM family.
Contains 1 MCM domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 539924 Cow
- Entrez Gene: 4176 Human
- Entrez Gene: 17220 Mouse
- Omim: 600592 Human
- SwissProt: Q3ZBH9 Cow
- SwissProt: P33993 Human
- SwissProt: Q61881 Mouse
- Unigene: 438720 Human
see all -
Alternative names
- CDABP0042 antibody
- CDC 47 antibody
- CDC47 antibody
see all
Images
-
All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/1000 dilution
Lane 1 : SiHa whole cell extract
Lane 2 : C33A whole cell extract
Lane 3 : WI38 whole cell extract
Lysates/proteins at 100000 cells per lane.
Predicted band size: 81 kDa -
All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/2000 dilution
Lane 1 : HeLa whole cell extract
Lane 2 : HeLa whole cell extract treated with 100 nM adriamycin for 24 hours
Lane 3 : NIH 3T3 whole cell extract
Predicted band size: 81 kDa -
Immunoprecipitation analysis on crude extracts of fibroblast cell line WI38 using ab179904.
Lane 1; Immunoprecipitation with pre-immune serum.
Lane 2; Immnoprecipitation with ab179904 antiserum.
Cells were labeled with S35 methionine and MCM7/PRL was immunoprecipitated with ab179904 followed by SDS-PAGE and autoradiography.
-
Immunofluorecent staining and confocal microscopic analysis of formaldehyde-fixed G1 phase HeLa cell nucleus, labeling MCM7/PRL using ab179904 at 1/200 dilution, after treatment with protein cross-linking reagent, DSP and chromatin extraction.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab179904 has been referenced in 4 publications.
- Wang Y et al. LSD1 is required for euchromatic origin firing and replication timing. Signal Transduct Target Ther 7:102 (2022). PubMed: 35414135
- Fujita M et al. Nuclear organization of DNA replication initiation proteins in mammalian cells. J Biol Chem 277:10354-61 (2002). PubMed: 11779870
- Fujita M et al. In vivo interaction of human MCM heterohexameric complexes with chromatin. Possible involvement of ATP. J Biol Chem 272:10928-35 (1997). PubMed: 9099751
- Fujita M et al. hCDC47, a human member of the MCM family. Dissociation of the nucleus-bound form during S phase. J Biol Chem 271:4349-54 (1996). PubMed: 8626784