Overview

  • Product name
    Anti-MCT2 antibody - C-terminal
    See all MCT2 primary antibodies
  • Description
    Rabbit polyclonal to MCT2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human MCT2 aa 392-441 (C terminal). The exact sequence is proprietary.
    Sequence:

    LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA


    Database link: O60669

  • Positive control
    • Human fetal heart tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function
    Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT2 is a high affinity pyruvate transporter.
  • Tissue specificity
    High expression in testis, moderate to low in spleen, heart, kidney, pancreas, skeletal muscle, brain and Leukocyte. Restricted expression in normal tissues, but widely expressed in cancer cells.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • MCT 2 antibody
    • MCT antibody
    • Monocarboxylate transporter 2 antibody
    • MonocarboxylateTransporter 2 antibody
    • MOT2 antibody
    • MOT2_HUMAN antibody
    • SLC16A7 antibody
    • Solute carrier family 16 (monocarboxylate transporter), member 7 antibody
    • Solute carrier family 16 member 7 antibody
    • Solute carrier Family 16 Monocarboxylic Acid Transporters Member 7 antibody
    • Solute carrier family 16, member 7 (monocarboxylic acid transporter 2) antibody
    see all

Images

  • Anti-MCT2 antibody - C-terminal (ab182178) at 1 µg/ml + Human fetal heart tissue lysate at 10 µg

    Predicted band size: 52 kDa

References

This product has been referenced in:
  • Alarcón P  et al. d(-) Lactic Acid-Induced Adhesion of Bovine Neutrophils onto Endothelial Cells Is Dependent on Neutrophils Extracellular Traps Formation and CD11b Expression. Front Immunol 8:975 (2017). Read more (PubMed: 28861083) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up