Overview

  • Product nameAnti-MECR antibody
    See all MECR primary antibodies
  • Description
    Rabbit polyclonal to MECR
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 290-339 (

    KQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG

    ) of Human MECR (NP_057095).

  • Positive control
    • Human fetal brain lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab116290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.
  • Tissue specificityHighly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
  • Sequence similaritiesBelongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localizationMitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI195831 antibody
    • CGI 63 antibody
    • FASN2B antibody
    • Homolog of yeast 2 enoyl thioester reductase antibody
    • HsNrbf-1 antibody
    • HsNrbf1 antibody
    • mecr antibody
    • MECR_HUMAN antibody
    • Mitochondrial 2 enoyl thioester reductase antibody
    • mitochondrial antibody
    • NRBF 1 antibody
    • NRBF-1 antibody
    • NRBF1 antibody
    • Nuclear receptor binding factor 1 antibody
    • Nuclear receptor-binding factor 1 antibody
    • OTTMUSP00000009996 antibody
    • RP23-13A13.1 antibody
    • Trans 2 enoyl CoA reductase, mitochondrial antibody
    • Trans-2-enoyl-CoA reductase antibody
    see all

Anti-MECR antibody images

  • Anti-MECR antibody (ab116290) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Predicted band size : 40 kDa

References for Anti-MECR antibody (ab116290)

ab116290 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"