Overview

  • Product nameAnti-MED31 antibody - ChIP Grade
    See all MED31 primary antibodies
  • Description
    Rabbit polyclonal to MED31 - ChIP Grade
  • Tested applicationsSuitable for: WB, ChIPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFV N) of Human MED31 (NP_057144).

  • Positive control
    • Human fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ChIP Use at an assay dependent concentration.

Target

  • RelevanceMED31 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • SOH1 antibody
    • CGI-125 antibody
    • hSOH1 antibody
    • Mediator complex subunit 31 antibody
    • Mediator complex subunit SOH1 antibody
    • Mediator of RNA polymerase II transcription subunit 31 antibody
    see all

Anti-MED31 antibody - ChIP Grade images

  • Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30 minutes) or (0, 30, 60 minutes) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

  • Anti-MED31 antibody - ChIP Grade (ab98142) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted 1/50,000

    Predicted band size : 16 kDa
    Gel concentration: 10-20%

References for Anti-MED31 antibody - ChIP Grade (ab98142)

ab98142 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"