Overview

  • Product name
  • Description
    Mouse polyclonal to MEIS1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MEIS1 aa 1-372.
    Sequence:

    MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCT PREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQ VLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSED ITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDG LDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP DGQPMGGFVMDGQQHMGIRAPGKTLFLW

Properties

Applications

Our Abpromise guarantee covers the use of ab167510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

Target

  • Function
    Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
  • Tissue specificity
    Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high levels in the cerebellum.
  • Involvement in disease
    Defects in MEIS1 could be a cause of susceptibility to restless legs syndrome type 7 (RLS7) [MIM:612853]. Restless legs syndrome (RLS) is a neurologic sleep/wake disorder characterized by uncomfortable and unpleasant sensations in the legs that appear at rest, usually at night, inducing an irresistible desire to move the legs. The disorder results in nocturnal insomnia and chronic sleep deprivation.
  • Sequence similarities
    Belongs to the TALE/MEIS homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Homeo box protein Meis1 antibody
    • Homeobox protein Meis1 antibody
    • Leukemogenic homolog protein antibody
    • MEIS 1 antibody
    • Meis homeo box 1 antibody
    • Meis homeobox 1 antibody
    • Meis1 antibody
    • Meis1 mouse homolog antibody
    • Meis1 myeloid ecotropic viral integration site 1 homolog antibody
    • Meis1 myeloid ecotropic viral integration site 1 homolog mouse antibody
    • MEIS1 protein antibody
    • MEIS1_HUMAN antibody
    • MGC43380 antibody
    • Myeloid ecotropic viral integration site 1 homolog antibody
    • WUGSC:H NH0444B04.1 antibody
    see all

Images

  • All lanes : Anti-MEIS1 antibody (ab167510) at 1 µg/ml

    Lane 1 : MEIS1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG HRP at 1/2500 dilution

    Predicted band size: 42 kDa

References

ab167510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up