
  • Product name
  • Description
    Rabbit polyclonal to MEPE
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within middle amino acids 350-399 (LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNE I) of Human MEPE (NP_064588).

  • Positive control
    • HeLa cell lysate



Our Abpromise guarantee covers the use of ab108073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-MEPE antibody (ab108073) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size: 58 kDa

    Gel concentration 12%


This product has been referenced in:
  • Meng X  et al. Regulatory roles of miRNA-758 and matrix extracellular phosphoglycoprotein in cervical cancer. Exp Ther Med 14:2789-2794 (2017). Read more (PubMed: 28928798) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108073.
Please use the links above to contact us or submit feedback about this product.


Sign up