
  • Product name
  • Description
    Rabbit polyclonal to MEPE
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within middle amino acids 350-399 (LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNE I) of Human MEPE (NP_064588).

  • Positive control
    • HeLa cell lysate



Our Abpromise guarantee covers the use of ab108073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MEPE antibody images

  • Anti-MEPE antibody (ab108073) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size : 58 kDa

References for Anti-MEPE antibody (ab108073)

ab108073 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108073.
Please use the links above to contact us or submit feedback about this product.


Sign up