Overview

  • Product name
  • Description
    Rabbit polyclonal to Meprin beta
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Meprin beta aa 524-630.
    Sequence:

    MTTDNGNYFWDRPSKVGTVALFPNGTQFRRGGGYGTSAFITHERLKSRDF IKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTV RD GKAECRC


    Database link: Q16820

  • Positive control
    • RT-4, U-251 MG, Human plasma, Human liver and Human tonsil lysates; Human small intestine tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 80 kDa.

Target

  • Function
    Membrane metallopeptidase that sheds many membrane-bound proteins. Known substrates include: FGF19, VGFA, IL1B, IL18, procollagen I and III, E-cadherin, KLK7, gastrin, ADAM10, tenascin-C. The presence of several pro-inflammatory cytokine among substrates implicate MEP1B in inflammation. It is also involved in tissue remodeling due to its capability to degrade extracellular matrix components.
  • Tissue specificity
    The major site of expression is the brush border membrane of small intestinal and kidney epithelial cells.
  • Sequence similarities
    Belongs to the peptidase M12A family.
    Contains 1 EGF-like domain.
    Contains 1 MAM domain.
    Contains 1 MATH domain.
  • Post-translational
    modifications
    N-glycosylated; contains high mannose and/or complex biantennary structures.
    O-glycosylation protect the C-terminal region from proteolytic cleavage and diminish secretion, this seems to be specific to human.
    Proteolytically activated by trypsin in the intestinal lumen and kallikrein-related peptidases in other tissues.
  • Cellular localization
    Cell membrane. Secreted. Homodimers are essentially membrane bound but may also be shed from the surface by ADAM-10 and ADAM-17.
  • Information by UniProt
  • Database links
  • Alternative names
    • Endopeptidase 2 antibody
    • Endopeptidase-2 antibody
    • kinase splitting membranal proteinase antibody
    • KSMP antibody
    • Mep1b antibody
    • MEP1B_HUMAN antibody
    • Meprin 1 beta subunit antibody
    • Meprin A beta antibody
    • Meprin A beta subunit precursor antibody
    • Meprin A subunit beta antibody
    • Meprin B antibody
    • N benzoyl L tyrosyl P amino benzoic acid hydrolase beta subunit antibody
    • N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit beta antibody
    • PABA peptide hydrolase antibody
    • PPH beta antibody
    see all

Images

  • All lanes : Anti-Meprin beta antibody (ab204886) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate


    Predicted band size : 80 kDa
  • Immunohistochemical analysis of Paraffin-embedded Human small intestine labeling Meprin beta with ab204886 at 1/20 dilution.

References

ab204886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up