Anti-Metabotropic Glutamate Receptor 6 antibody (ab90866)

Overview

  • Product nameAnti-Metabotropic Glutamate Receptor 6 antibody
    See all Metabotropic Glutamate Receptor 6 primary antibodies
  • Description
    Rabbit polyclonal to Metabotropic Glutamate Receptor 6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 360-409 (

    FWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVY

    ) of Human Metabotropic Glutamate Receptor 6 (NP_000834)

  • Positive control
    • Human fetal small intestine lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 95 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
  • Involvement in diseaseDefects in GRM6 are the cause of congenital stationary night blindness type 1B (CSNB1B) [MIM:257270]. This disorder consits of a previously unrecognized, autosomal recessive form of congenital night blindness associated with a negative electroretinogram waveform. Patients are night blind from an early age, and when maximally dark-adapted, they could perceive lights only with an intensity equal to or slightly dimmer than that normally detected by the cone system. ERGs in response to single brief flashes of light have clearly detectable a-waves, which are derived from photoreceptors, and greatly reduced b-waves, which are derived from the second-order inner retinal neurons. ERGs in response to sawtooth flickering light indicate a markedly reduced ON response and a nearly normal OFF response. There is no subjective delay in the perception of suddenly appearing white vs black objects on a gray background.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 3 family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CSNB1B antibody
    • DKFZp686H1993 antibody
    • GluR6 antibody
    • Glutamate receptor metabotropic 6 antibody
    • GPRC1F antibody
    • Grm6 antibody
    • GRM6_HUMAN antibody
    • Metabotropic glutamate receptor 6 antibody
    • mGlu6 antibody
    • mGluR6 antibody
    see all

Anti-Metabotropic Glutamate Receptor 6 antibody images

  • Anti-Metabotropic Glutamate Receptor 6 antibody (ab90866) at 1 µg/ml + Human fetal small intestine lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 95 kDa

References for Anti-Metabotropic Glutamate Receptor 6 antibody (ab90866)

ab90866 has not yet been referenced specifically in any publications.

Product Wall

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement for one vial of ab90866. To check the status of the order please contact our Customer...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"