Overview

  • Product name
    Anti-metC antibody (Biotin)
  • Description
    Rabbit polyclonal to metC (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant fragment corresponding to Escherichia coli metC aa 1-392.
    Sequence:

    MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRA NGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQ GDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKI VFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFG IDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAY ITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILAN QPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFA


    Database link: P06721

Properties

Applications

Our Abpromise guarantee covers the use of ab192953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/500.

Target

  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homocysteine from L-cystathionine: step 1/1.
  • Sequence similarities
    Belongs to the trans-sulfuration enzymes family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
    • Alternative names
      • Beta-cystathionase antibody
      • CBL antibody
      • Cystathionine beta lyase PLP dependent antibody
      • Cystathionine beta-lyase metC antibody
      • Cysteine lyase antibody
      • metC antibody
      • METC_ECOLI antibody
      see all

    Images

    • All lanes : Anti-metC antibody (Biotin) (ab192953) at 0.36 µg/ml

      All lanes : Rosseta bacteria lysate

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Observed band size: 44 kDa (why is the actual band size different from the predicted?)

    References

    ab192953 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab192953.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up