Anti-Methyltransferase-like protein 10 antibody (ab122963)


  • Product nameAnti-Methyltransferase-like protein 10 antibody
    See all Methyltransferase-like protein 10 primary antibodies
  • Description
    Rabbit polyclonal to Methyltransferase-like protein 10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Guinea pig, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 151-200 (VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAEL L) of Mouse Methyltransferase-like protein 10 (NP_082371).

  • Positive control
    • Mouse spleen lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab122963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-Methyltransferase-like protein 10 antibody images

  • Anti-Methyltransferase-like protein 10 antibody (ab122963) at 1 µg/ml + Mouse spleen lysate at 10 µg

    Predicted band size : 27 kDa

References for Anti-Methyltransferase-like protein 10 antibody (ab122963)

ab122963 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122963.
Please use the links above to contact us or submit feedback about this product.