Overview

  • Product name
  • Description
    Rabbit polyclonal to METTL3
  • Tested applications
    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human METTL3 aa 1-50 (N terminal).
    Sequence:

    MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS

  • Positive control
    • IHC-P: Human intestinal tissue sections WB: Fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab66660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 54 kDa (predicted molecular weight: 64 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

  • Function
    N6-methyltransferase that methylates adenosine residues of some mRNAs. N6-methyladenosine (m6A), which is present at internal sites of some mRNAs, may play a role in the efficiency of mRNA splicing, transport or translation.
  • Tissue specificity
    Widely expressed at low level. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the MT-A70-like family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus speckle. Colocalizes with speckles in interphase nuclei. Suggesting that it may be associated with nuclear pre-mRNA splicing components.
  • Information by UniProt
  • Database links
  • Alternative names
    • adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase antibody
    • IME4 antibody
    • M6A antibody
    • Methyltransferase like protein 3 antibody
    • Methyltransferase-like protein 3 antibody
    • METTL3 antibody
    • mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase antibody
    • mRNA m(6)A methyltransferase antibody
    • MT-A70 antibody
    • MTA70 antibody
    • MTA70_HUMAN antibody
    • N6 adenosine methyltransferase 70 kDa subunit antibody
    • N6-adenosine-methyltransferase 70 kDa subunit antibody
    see all

Images

  • Anti-METTL3 antibody (ab66660) at 5 µg/ml + fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 54 kDa (why is the actual band size different from the predicted?)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling METTL3 with ab66660 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the intestinal villus. Magnification: 400X.

References

ab66660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab66660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up