Overview

  • Product nameAnti-METTL3 antibody
    See all METTL3 primary antibodies
  • Description
    Rabbit polyclonal to METTL3
  • Tested applicationsSuitable for: WB, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human METTL3 aa 1-50 (N terminal).
    Sequence:

    MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS

  • Positive control
    • IHC-P: Human intestinal tissue sections WB: Fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab66660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 54 kDa (predicted molecular weight: 64 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

  • FunctionN6-methyltransferase that methylates adenosine residues of some mRNAs. N6-methyladenosine (m6A), which is present at internal sites of some mRNAs, may play a role in the efficiency of mRNA splicing, transport or translation.
  • Tissue specificityWidely expressed at low level. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the MT-A70-like family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus speckle. Colocalizes with speckles in interphase nuclei. Suggesting that it may be associated with nuclear pre-mRNA splicing components.
  • Information by UniProt
  • Database links
  • Alternative names
    • adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase antibody
    • IME4 antibody
    • M6A antibody
    • Methyltransferase like protein 3 antibody
    • Methyltransferase-like protein 3 antibody
    • METTL3 antibody
    • mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase antibody
    • mRNA m(6)A methyltransferase antibody
    • MT-A70 antibody
    • MTA70 antibody
    • MTA70_HUMAN antibody
    • N6 adenosine methyltransferase 70 kDa subunit antibody
    • N6-adenosine-methyltransferase 70 kDa subunit antibody
    see all

Anti-METTL3 antibody images

  • Anti-METTL3 antibody (ab66660) at 5 µg/ml + fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 54 kDa (why is the actual band size different from the predicted?)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling METTL3 with ab66660 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the intestinal villus. Magnification: 400X.

References for Anti-METTL3 antibody (ab66660)

ab66660 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab66660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"