Overview

  • Product name
  • Description
    Rabbit polyclonal to MGAT4B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MGAT4B aa 82-240. (BC009464)
    Sequence:

    IAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFG DPKERVRWRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNF ALQQPSEDWMILEFSQLGFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLD HILWVKVCN


    Database link: Q9UQ53

  • Positive control
    • HepG2 & Human fetal kidney lysates, Human kidney tissue

Properties

  • Form
    Lyophilised:Reconstitute in 200ul sterile H2O.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 63 kDa.

Target

  • Function
    Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.
  • Tissue specificity
    Widely expressed. Strongly overexpressed in pancreatic cancer.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 54 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3-D-mannoside beta-1 antibody
    • 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B antibody
    • 4-N-acetylglucosaminyltransferase IVb antibody
    • Alpha 1 3 mannosyl glycoprotein beta 1 4 N acetylglucosaminyltransferase antibody
    • Alpha-1 antibody
    • Aminyltransferase antibody
    • GlcNAc T IVb antibody
    • GlcNAc-T IVb antibody
    • GNT IV antibody
    • GNT IVB antibody
    • GnT-IVb antibody
    • GNTIV antibody
    • GNTIVB antibody
    • Mannosyl (alpha 1 3) glycoprotein beta 1 4 N acetylglucosaminyltransferase isozyme B antibody
    • MGAT 4B antibody
    • mgat4b antibody
    • MGT4B_HUMAN antibody
    • N acetylglucosaminyltransferase IVb antibody
    • N glycosyl oligosaccharide glycoprotein antibody
    • N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase IVb antibody
    • N-acetylglucosaminyltransferase IVb antibody
    • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb antibody
    • UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IV antibody
    • UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IVb antibody
    • UDP-N-acetylglucosamine: alpha-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue labeling MGAT4B with ab177206 at 1/100 dilution.

  • All lanes : Anti-MGAT4B antibody (ab177206) at 1/500 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : Human fetal kidney lysate

    Predicted band size: 63 kDa

References

ab177206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up