Overview

  • Product nameAnti-MGC35062 antibody
    See all MGC35062 primary antibodies
  • Description
    Rabbit polyclonal to MGC35062
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Dog, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 144-193 (

    ANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESI

    ) of Human MGC35062 (NP_940917)

  • Positive control
    • Human placenta lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab90021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceMGC35062 belongs to the UPF0628 family. The specific function of this protein remains unknown.
  • Database links
  • Alternative names
    • C10orf96 antibody
    • chromosome 10 open reading frame 96 antibody
    • hypothetical protein LOC374355 antibody
    • UPF0628 protein C10orf96 antibody

Anti-MGC35062 antibody images

  • Anti-MGC35062 antibody (ab90021) at 1 µg/ml + Human placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 31 kDa

References for Anti-MGC35062 antibody (ab90021)

ab90021 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"