Overview

  • Product nameAnti-MICALCL antibody
    See all MICALCL primary antibodies
  • Description
    Rabbit polyclonal to MICALCL
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: IRRSLEPLLSNSEGGKKAWAKQESKTLPTQACTRSFSLRKTNSNKDGDQH SPGRNQSSAF SPPDPALRTHSLPNRPSKVFPALRSPPCSKIEDVPTLL, corresponding to amino acids 277-374 of Human MICALCL (Q6ZW33). Note: at position 305, A was substituted with T. This is a natural variant.

  • Positive control
    • Human pancreas

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab122650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • FunctionMay cooperate with MAPK1/ERK2 via an intracellular signal transduction pathway in the morphogenetic development of round spermatids to spermatozoa.
  • Sequence similaritiesBelongs to the ebitein family.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ebitein-1 antibody
    • EBITEIN1 antibody
    • ERK2-binding testicular protein 1 antibody
    • FLJ14966 antibody
    • MICAL C-terminal-like protein antibody
    • Micalcl antibody
    • MICLK_HUMAN antibody
    • OTTHUMP00000230951 antibody
    see all

Anti-MICALCL antibody images

  • ab122650, at 1/50, staining MICALCL in paraffin embedded Human pancreas tissue by Immunohistochemistry.

References for Anti-MICALCL antibody (ab122650)

ab122650 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"