
  • Product name
  • Description
    Rabbit polyclonal to MICALCL
  • Host species
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: IRRSLEPLLSNSEGGKKAWAKQESKTLPTQACTRSFSLRKTNSNKDGDQH SPGRNQSSAF SPPDPALRTHSLPNRPSKVFPALRSPPCSKIEDVPTLL, corresponding to amino acids 277-374 of Human MICALCL (Q6ZW33). Note: at position 305, A was substituted with T. This is a natural variant.

  • Positive control
    • Human pancreas



Our Abpromise guarantee covers the use of ab122650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.


  • Function
    May cooperate with MAPK1/ERK2 via an intracellular signal transduction pathway in the morphogenetic development of round spermatids to spermatozoa.
  • Sequence similarities
    Belongs to the ebitein family.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • Ebitein-1 antibody
    • EBITEIN1 antibody
    • ERK2-binding testicular protein 1 antibody
    • FLJ14966 antibody
    • MICAL C-terminal-like protein antibody
    • Micalcl antibody
    • MICLK_HUMAN antibody
    • OTTHUMP00000230951 antibody
    see all


  • ab122650, at 1/50, staining MICALCL in paraffin embedded Human pancreas tissue by Immunohistochemistry.


ab122650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122650.
Please use the links above to contact us or submit feedback about this product.


Sign up