
  • Product nameAnti-MIER2 antibody
    See all MIER2 primary antibodies
  • Description
    Rabbit polyclonal to MIER2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 287-336 (RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVG E) of Human MIER2 (NP_060020).

  • Positive control
    • Human fetal stomach lysate.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab99019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MIER2 antibody images

  • Anti-MIER2 antibody (ab99019) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 60 kDa

References for Anti-MIER2 antibody (ab99019)

ab99019 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99019.
Please use the links above to contact us or submit feedback about this product.