Anti-MIRO1 antibody (ab55035)

Overview

  • Product name
  • Description
    Mouse monoclonal to MIRO1
  • Tested applications
    Suitable for: WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MIRO1 aa 483-581.
    Sequence:

    TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLH EVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP


    Database link: Q8IXI2

  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and has decided to discontinue this product by July 2018 as it has been generated by the ascites method. We are sorry for any inconvenience this may cause. 

Properties

Applications

Our Abpromise guarantee covers the use of ab55035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
Flow Cyt Use 1µg for 106 cells. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity
    Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization
    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHT 1 antibody
    • ARHT1 antibody
    • FLJ11040 antibody
    • FLJ12633 antibody
    • hMiro 1 antibody
    • hMiro-1 antibody
    • hMiro1 antibody
    • MIRO 1 antibody
    • MIRO-1 antibody
    • MIRO1 antibody
    • MIRO1_HUMAN antibody
    • mitochondrial Rho (MIRO) GTPase 1 antibody
    • Mitochondrial Rho 1 antibody
    • Mitochondrial Rho GTPase 1 antibody
    • Mitochondrial Rho1 antibody
    • Rac GTP binding protein like protein antibody
    • Rac-GTP-binding protein-like protein antibody
    • Ras homolog family member T1 antibody
    • Ras homolog gene family member T1 antibody
    • Rhot 1 antibody
    • RHOT1 antibody
    see all

Anti-MIRO1 antibody images

  • Rhot1 antibody (ab55035) at 1ug/lane + HeLa cell lysate at 25ug/lane.
  • Overlay histogram showing HepG2 cells stained with ab55035 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55035, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HepG2 cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

References for Anti-MIRO1 antibody (ab55035)

ab55035 has not yet been referenced specifically in any publications.

Product Wall

Application
Western blot
Sample
Rat Cell lysate - whole cell (heart)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jul 16 2015

Gracias por ponerte en contacto con nosotros. En nuestro catálogo se encuentran disponibles dos anticuerpos contra la proteína Miro-1: ab55035: http://www.abcam.com/Rhot1-antibody-ab55035.html Que solo se ha testado en WB y sELISA, y reconoce la forma ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up