Overview

  • Product name
  • Description
    Rabbit polyclonal to MIRO1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human MIRO1 aa 396-445 (internal sequence).
    Sequence:

    ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR


    Database link: Q8IXI2

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity
    Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization
    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHT 1 antibody
    • ARHT1 antibody
    • FLJ11040 antibody
    • FLJ12633 antibody
    • hMiro 1 antibody
    • hMiro-1 antibody
    • hMiro1 antibody
    • MIRO 1 antibody
    • MIRO-1 antibody
    • MIRO1 antibody
    • MIRO1_HUMAN antibody
    • mitochondrial Rho (MIRO) GTPase 1 antibody
    • Mitochondrial Rho 1 antibody
    • Mitochondrial Rho GTPase 1 antibody
    • Mitochondrial Rho1 antibody
    • Rac GTP binding protein like protein antibody
    • Rac-GTP-binding protein-like protein antibody
    • Ras homolog family member T1 antibody
    • Ras homolog gene family member T1 antibody
    • Rhot 1 antibody
    • RHOT1 antibody
    see all

Anti-MIRO1 antibody images

  • Anti-MIRO1 antibody (ab83779) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 35 kDa. We are unsure as to the identity of these extra bands.

References for Anti-MIRO1 antibody (ab83779)

This product has been referenced in:

See 1 Publication for this product

Product Wall

Gracias por ponerte en contacto con nosotros. En nuestro catálogo se encuentran disponibles dos anticuerpos contra la proteína Miro-1: ab55035: http://www.abcam.com/Rhot1-antibody-ab55035.html Que solo se ha testado en WB y sELISA, y reconoce la forma ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up