Anti-MNAT1 antibody (ab175398)
Key features and details
- Rabbit polyclonal to MNAT1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MNAT1 antibody
See all MNAT1 primary antibodies -
Description
Rabbit polyclonal to MNAT1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human MNAT1 aa 1-309.
Sequence:MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEA LEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQ HKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQP LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA FSGLFWQPS
Database link: P51948 -
Positive control
- A431 and Hela cell extracts.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175398 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 36 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 36 kDa. |
Target
-
Function
Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. -
Tissue specificity
Highest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes. -
Sequence similarities
Contains 1 RING-type zinc finger.
Contains 1 UIM (ubiquitin-interacting motif) repeat. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 4331 Human
- Omim: 602659 Human
- SwissProt: P51948 Human
- Unigene: 509523 Human
-
Alternative names
- MNAT 1 antibody
- CAP35 antibody
- CDK activating kinase assembly factor MAT1 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175398 has not yet been referenced specifically in any publications.