Overview

  • Product name
  • Description
    Rabbit polyclonal to MNAT1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MNAT1 aa 1-309.
    Sequence:

    MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEA LEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQ HKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQP LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA FSGLFWQPS


    Database link: P51948

  • Positive control
    • A431 and Hela cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab175398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 36 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.
  • Tissue specificity
    Highest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MNAT 1 antibody
    • CAP35 antibody
    • CDK activating kinase assembly factor MAT1 antibody
    • CDK-activating kinase assembly factor MAT1 antibody
    • CDK7/cyclin H assembly factor antibody
    • CDK7/cyclin-H assembly factor antibody
    • Cyclin G1 interacting protein antibody
    • Cyclin-G1-interacting protein antibody
    • MAT1 antibody
    • MAT1_HUMAN antibody
    • Menage a trois 1 (CAK assembly factor) antibody
    • Menage a trois antibody
    • Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) antibody
    • MNAT CDK activating kinase assembly factor 1 antibody
    • Mnat1 antibody
    • p35 antibody
    • p36 antibody
    • RING finger protein 66 antibody
    • RING finger protein MAT1 antibody
    • RNF66 antibody
    • TFB3 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat brain tissue labelling MNAT1 with ab175398 at 1/200. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175398. Blue DAPI for nuclear staining.
  • All lanes : Anti-MNAT1 antibody (ab175398) at 1/500 dilution

    Lane 1 : A431 cell extract
    Lane 2 : Hela cell extract

    Predicted band size: 36 kDa

References

ab175398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up