Overview

  • Product name
    Anti-MNDA antibody [253A]
    See all MNDA primary antibodies
  • Description
    Mouse monoclonal [253A] to MNDA
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
    Unsuitable for: IHC-Fr
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human MNDA aa 1-425. The immunogen was also conjugated to a proprietary tag.
    Sequence:

    MVNEYKRIVLLRGLECINKHYFSLFKSLLARDLNLERDNQEQYTTIQIAN MMEEKFPADSGLGKLIEFCEEVPALRKRAEILKKERSEVTGETSLEKNGQ EAGPATPTSTTSHMLASERGETSATQEETSTAQAGTSTAQAGTSTAQAGT STAQKRKSMREEETGVKKSKAAKEPDQPPCCEEPTAMCQSPILHSSSSAS SNILSAKNQKSQPQNQNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVK NMFHATVATVSQYFHVKVFNIDLKEKFTKNNFITISNYFESKGILEINET SSVLEAAPKQMIEVPNCITRNANASPKICDIQKGTSGTVFYGVFTLHKKK VKTQNTSYEIKDGSGSIEVVGSGQWHNINCKEGDKLHLFCFHLKRERGQP KLVCGDHSFVKVTKAGKKKEASTVQ


    Database link: Q08619

  • Positive control
    • V5-tagged MNDA expressed in Hek293T, Hek-v5-MNDA, Z138, MINO and MT-2 cell lines. Human tonsil, lymph node and kidney tissue..

Properties

Applications

Our Abpromise guarantee covers the use of ab188566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/600 - 1/1000. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa).
ICC/IF Use at an assay dependent concentration.
  • Application notes
    Is unsuitable for IHC-Fr.
  • Target

    • Function
      May act as a transcriptional activator/repressor in the myeloid lineage. Plays a role in the granulocyte/monocyte cell-specific response to interferon. Stimulates the DNA binding of the transcriptional repressor protein YY1.
    • Tissue specificity
      Expressed constitutively in cells of the myeloid lineage. Found in promyelocyte stage cells as well as in all other stage cells including peripheral blood monocytes and granulocytes. Also appear in myeloblast cells in some cases of acute myeloid Leukemia.
    • Sequence similarities
      Contains 1 DAPIN domain.
      Contains 1 HIN-200 domain.
    • Domain
      Its N-terminal half (200 amino acids) is sufficient for maximum enhancement of YY1 DNA binding and a portion of this sequence is responsible for binding YY1.
    • Cellular localization
      Nucleus. Cytoplasm. Uniformly distributed throughout the interphase cell nucleus. Associates with chromatin.
    • Information by UniProt
    • Database links
    • Alternative names
      • MNDA antibody
      • MNDA_HUMAN antibody
      • Myeloid cell nuclear differentiation antigen antibody
      • OTTHUMP00000024384 antibody
      • PYHIN3 antibody
      see all

    Images

    • All lanes : Anti-MNDA antibody [253A] (ab188566)

      Lane 1 : Hek-v5-MNDA cell line (Positive)
      Lane 2 : Hek-v5-CD1D cell line (Negative control)
      Lane 3 : HL60 cell line (Negative)
      Lane 4 : K562 cell line (Negative)
      Lane 5 : Z138 cell line (Positive)
      Lane 6 : MINO cell line (Positive)
      Lane 7 : YT cell line (Negative)
      Lane 8 : MT-2 cell line (Positive)

      Lysates/proteins at 100 µg per lane.


      Predicted band size : 47 kDa
      Observed band size : 50 kDa (why is the actual band size different from the predicted?)
    • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling MNDA with ab188566 undiluted.

    • Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling MNDA with ab188566 undiluted.

    • Immunohistochemical analysis of paraffin-embedded Human Tonsil tissue labeling MNDA with ab188566 undiluted.

    • Left Panel: Immunocytochemistry analysis of V5-tagged MNDA expressed in Hek293T labeling MNDA with ab188566

      Middle Panel: Shows labeling with the anti-V5 to confirm the efficiency of the transfection.

      Right Panel: Preparation of NANOG transfected cells used as a negative control.

       Frozen cytospins preparations were used for the analysis

    • Immunofluorescent analysis of Human tonsil labeling MNDA with ab188566 undiluted (green)

    References

    ab188566 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Abcam has not validated the combination of species/application used in this Abreview.
    Application
    Western blot
    Sample
    Mouse Cell lysate - whole cell (RAW 264.7 cells)
    Gel Running Conditions
    Reduced Denaturing (12% gel (Acrylamide))
    Loading amount
    20 µg
    Treatment
    Interferon bete (2h, 6h, 12h, 24h)
    Specification
    RAW 264.7 cells
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
    Username

    Abcam user community

    Verified customer

    Submitted Mar 17 2016

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up