Overview

  • Product name
    Anti-Moesin antibody [MSN491]
    See all Moesin primary antibodies
  • Description
    Mouse monoclonal [MSN491] to Moesin
  • Tested applications
    Suitable for: WB, IHC-Fr, IHC-P, Flow Cyt, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Moesin aa 1-577.
    Sequence:

    MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQ DTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGD KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK EALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQ MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMR LGRDKYKTLRQIRQGNTKQRIDEFESM


    Database link: P26038

  • Positive control
    • HT29, CH3LC, or HUVEC cells. Uterus, placenta, tonsil (both B and T lymphocytes), skeletal muscle, thyroid, or kidney; Human placenta tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    MSN491
  • Isotype
    IgG1
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 68 kDa.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use a concentration of 0.5 - 1 µg/ml. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
IP Use at 0.25-0.5 µg/mg of lysate.

Target

  • Function
    Probably involved in connections of major cytoskeletal structures to the plasma membrane.
  • Tissue specificity
    In all tissues and cultured cells studied.
  • Sequence similarities
    Contains 1 FERM domain.
  • Post-translational
    modifications
    Phosphorylation on Thr-558 is crucial for the formation of microvilli-like structures.
  • Cellular localization
    Cell membrane. Cytoplasm > cytoskeleton. Apical cell membrane. Cell projection > microvillus membrane. Phosphorylated form is enriched in microvilli-like structures at apical membrane (By similarity). Increased cell membrane localization of both phosphorylated and non-phosphorylated forms seen after thrombin treatment.
  • Information by UniProt
  • Database links
  • Alternative names
    • Epididymis luminal protein 70 antibody
    • HEL70 antibody
    • Membrane organizing extension spike protein antibody
    • Membrane-organizing extension spike protein antibody
    • MOES_HUMAN antibody
    • Moesin antibody
    • Moesin/anaplastic lymphoma kinase fusion protein antibody
    • Msn antibody
    • MSN/ALK fusion antibody
    see all

Images

  • Anti-Moesin antibody [MSN491] (ab193380) at 1 µg/ml + HT29 cell lysate

    Predicted band size : 68 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling Moesin with ab193380 at 1 µg/ml.

References

ab193380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up