Overview

  • Product name
    Anti-Mohawk homeobox antibody - C-terminal
    See all Mohawk homeobox primary antibodies
  • Description
    Rabbit polyclonal to Mohawk homeobox - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse Mohawk homeobox aa 257-306 (C terminal). The exact sequence is proprietary. (NP_808263).
    Sequence:

    SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW


    Database link: Q8BIA3

  • Positive control
    • Mouse liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.

Target

Images

  • Anti-Mohawk homeobox antibody - C-terminal (ab179597) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 39 kDa

References

This product has been referenced in:
  • Wang Y  et al. Osteocalcin expressing cells from tendon sheaths in mice contribute to tendon repair by activating Hedgehog signaling. Elife 6:N/A (2017). Read more (PubMed: 29244023) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up