Anti-Monoacylglycerol Lipase antibody (ab108176)

Overview

  • Product nameAnti-Monoacylglycerol Lipase antibody
    See all Monoacylglycerol Lipase primary antibodies
  • Description
    Rabbit polyclonal to Monoacylglycerol Lipase
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTG T) of Human Monoacylglycerol Lipase (NM_007283).

  • Positive control
    • ACHN cell lysate

Applications

Our Abpromise guarantee covers the use of ab108176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionConverts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
  • Tissue specificityDetected in adipose tissue, lung, liver, kidney, brain and heart.
  • PathwayGlycerolipid metabolism; triacylglycerol degradation.
  • Sequence similaritiesBelongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 3.1.1.23 antibody
    • HU K5 antibody
    • HU-K5 antibody
    • HUK5 antibody
    • Lysophospholipase homolog antibody
    • Lysophospholipase like antibody
    • Lysophospholipase-like antibody
    • MAGL antibody
    • MGL antibody
    • MGLL antibody
    • MGLL_HUMAN antibody
    • Monoacylglycerol lipase antibody
    • Monoglyceride lipase antibody
    see all

Anti-Monoacylglycerol Lipase antibody images

  • Anti-Monoacylglycerol Lipase antibody (ab108176) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-Monoacylglycerol Lipase antibody (ab108176)

ab108176 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"