Overview

  • Product name
  • Description
    Rabbit polyclonal to MORC3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MORC3 aa 190-269.
    Sequence:

    GKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQER MDQIAPESDYSLRAYCSILYLKPRMQIILR


    Database link: Q14149

  • Positive control
    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).
  • Tissue specificity
    Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.
  • Sequence similarities
    Contains 1 CW-type zinc finger.
  • Post-translational
    modifications
    Sumoylation is involved in interaction with PML and localization to PML nuclear bodies.
  • Cellular localization
    Nucleus, nucleoplasm. Nucleus matrix. Nucleus, PML body. Also found in PML-independent nuclear bodies. Localization to nuclear bodies is ATP-dependent.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA0136 antibody
    • Microrchidia 3 antibody
    • MORC family CW type zinc finger 3 antibody
    • MORC family CW type zinc finger protein 3 antibody
    • MORC family CW-type zinc finger protein 3 antibody
    • MORC3 antibody
    • MORC3_HUMAN antibody
    • Nuclear matrix protein 2 antibody
    • Nuclear matrix protein NXP2 antibody
    • NXP2 antibody
    • ZCW5 antibody
    • ZCWCC3 antibody
    • Zinc finger CW type coiled coil domain 3 antibody
    • Zinc finger CW type coiled coil domain protein 3 antibody
    • Zinc finger CW type with coiled coil domain 3 antibody
    • Zinc finger CW-type coiled-coil domain protein 3 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for MORC3 (green) using ab222086 at 4 µg/ml in ICC/IF.

References

ab222086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up