Overview

  • Product name
  • Description
    Rabbit polyclonal to MOT8
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human MOT8 aa 93-142. NP_006508.2.
    Sequence:

    QPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQ


    Database link: P36021

  • Positive control
    • Human Adrenal tissue; HT29 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 60 kDa.
IHC-P Use a concentration of 5 µg/ml.

Target

  • Function
    Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.
  • Tissue specificity
    Highly expressed in liver and heart.
  • Involvement in disease
    Monocarboxylate transporter 8 deficiency
  • Sequence similarities
    Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AHDS antibody
    • DXS 128 antibody
    • DXS 128E antibody
    • DXS128 antibody
    • DXS128 E antibody
    • DXS128E antibody
    • MCT 7 antibody
    • MCT 8 antibody
    • MCT7 antibody
    • MCT8 antibody
    • Monocarboxylate transporter 7 antibody
    • Monocarboxylate transporter 8 antibody
    • MOT 8 antibody
    • MOT8_HUMAN antibody
    • MRX 22 antibody
    • MRX22 antibody
    • SLC16 A2 antibody
    • SLC16A 2 antibody
    • SLC16A2 antibody
    • Solute carrier family 16 (monocarboxylic acid transporters), member 2 antibody
    • Solute carrier family 16 member 2 antibody
    • Solute carrier family 16, member 2 (monocarboxylic acid transporter 8) antibody
    • Solute carrier family 16, member 2 (thyroid hormone transporter) antibody
    • Solute carrier family 16, member 2 antibody
    • X linked PEST containing transporter antibody
    • X-linked PEST-containing transporter antibody
    • XPCT antibody
    see all

Images

  • Anti-MOT8 antibody (ab192828) at 1/500 dilution + HT29 cell lysate

    Predicted band size : 60 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human adrenal tissue labeling MOT8 with ab192828 at 5 µg/ml.

References

ab192828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Fukomys mechowii Tissue sections (Cerebellum)
Antigen retrieval step
None
Permeabilization
No
Specification
Cerebellum
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Paraformaldehyde
Username

Mr. Yoshiyuki Henning

Verified customer

Submitted Jun 18 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up