
  • Product name
  • Description
    Rabbit polyclonal to Motilin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 35-84 (LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPL E) of Human Motilin (NP_002409)

  • Positive control
    • HT1080 whole cell lysate.



Our Abpromise guarantee covers the use of ab98874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Sequence similarities
    Belongs to the motilin family.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • MAP antibody
    • MGC138519 antibody
    • MLN antibody
    • MOTI_HUMAN antibody
    • Motilin-associated peptide antibody
    • Promotilin antibody
    see all

Anti-Motilin antibody images

  • Anti-Motilin antibody (ab98874) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Predicted band size : 13 kDa

References for Anti-Motilin antibody (ab98874)

ab98874 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98874.
Please use the links above to contact us or submit feedback about this product.


Sign up