Overview

  • Product name
  • Description
    Rabbit polyclonal to Motilin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 35-84 (LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPL E) of Human Motilin (NP_002409)

  • Positive control
    • HT1080 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Sequence similarities
    Belongs to the motilin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • MAP antibody
    • MGC138519 antibody
    • MLN antibody
    • MOTI_HUMAN antibody
    • Motilin-associated peptide antibody
    • Promotilin antibody
    see all

Images

  • Anti-Motilin antibody (ab98874) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Predicted band size : 13 kDa

References

ab98874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up