Overview

  • Product name
    Anti-Mov10 antibody [15C1B8]
    See all Mov10 primary antibodies
  • Description
    Mouse monoclonal [15C1B8] to Mov10
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Mov10 aa 953-1003. The exact sequence is proprietary. NP_066014.1.
    Sequence:

    LDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNE L


    Database link: Q9HCE1

  • Positive control
    • Mouse NIH3T3, 293T, HeLa and Jurkat lysate. Human testicular seminoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/2000.
WB 1/1000 - 1/10000. Predicted molecular weight: 114 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Relevance
    MOV10 may be an helicase with an important function in development and/or control of cell proliferation. RNA silencing processes are guided by small RNAs known as siRNAs and microRNAs (miRNAs). They reside in ribonucleoprotein complexes, which guide the cleavage of complementary mRNAs or affect stability and translation of partial complementary mRNAs. Argonaute (Ago) proteins are at the heart of silencing effector complexes and bind the single-stranded siRNA and miRNA. Ago1- and Ago2-containing complexes have been purified from human cells, resulting in the discovery of novel factors such as the putative RNA helicase MOV10, and the RNA recognition motif (RRM)-containing protein TNRC6B/KIAA1093. The new proteins localize, similar to Ago proteins, to mRNA-degrading cytoplasmic P bodies, and they are functionally required to mediate miRNA-guided mRNA cleavage.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • DKFZp667O1423 antibody
    • FLJ32791 antibody
    • fSAP113 antibody
    • Functional spliceosome-associated protein 113 antibody
    • gb110 antibody
    • MGC2948 antibody
    • Moloney leukemia virus 10 protein antibody
    • MOV 10 antibody
    • Mov10 (Moloney leukemia virus 10, mouse) homolog antibody
    • Mov10 (Moloney leukemia virus 10,) homolog antibody
    • Mov10, Moloney leukemia virus 10, homolog (mouse) antibody
    • Mov10, Moloney leukemia virus 10, homolog antibody
    • Putative helicase MOV10 antibody
    see all

Images

  • All lanes : Anti-Mov10 antibody [15C1B8] (ab176687) at 0.1 µg/ml

    Lane 1 : Mouse NIH-3T3 lysate at 50 µg
    Lane 2 : Mouse NIH-3T3 lysate at 15 µg
    Lane 3 : 293T lysate at 50 µg
    Lane 4 : HeLa lysate at 50 µg
    Lane 5 : Jurkat lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 114 kDa


    Exposure time: 3 minutes
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testicular seminoma tissue labeling Mov10 with ab176687 at a 1/1000 dilution. DAB staining.

  • Detection of Human Mov10 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP Mouse NIH3T3 whole cell lysate loaded. ab176687 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated Mov10, ab176687 was used at 1 µg/ml.

References

ab176687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up