Overview

  • Product nameAnti-MPP7 antibody
    See all MPP7 primary antibodies
  • Description
    Rabbit polyclonal to MPP7
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (

    PALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLV

    ) of Human MPP7 (NP_775767).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-MPP7 antibody images

  • Anti-MPP7 antibody (ab87216) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 66 kDa
    Observed band size : 60 kDa (why is the actual band size different from the predicted?)

References for Anti-MPP7 antibody (ab87216)

ab87216 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"