Overview

  • Product name
  • Description
    Rabbit polyclonal to MPPED2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein corresponding to Human MPPED2 aa 1-294.
    Sequence:

    MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYD TPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFN DWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFD NVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKW NLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVF GGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS


    Database link: NP_001575.1

  • Positive control
    • MPPED2 transfected 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Relevance
    MMPED2 (Metallophosphoesterase domain containing 2) displays low metallophosphoesterase activity (in vitro). It is predominantly expressed in the fetal brain and is thought to have a role in development of the nervous system. Alternatively spliced transcript variants have been described.
  • Database links
  • Alternative names
    • MPPED2 antibody
    • 239FB antibody
    • Brain protein 239 antibody
    • C11orf8 antibody
    • Chromosome 11 open reading frame 8 antibody
    • D11S302E antibody
    • dJ1024C24.1 antibody
    • dJ873F21.1 antibody
    • FAM 1B antibody
    • FAM1B antibody
    • Fetal brain protein 239 antibody
    • Hs.46638 antibody
    • Metallophosphoesterase domain containing 2 antibody
    • Metallophosphoesterase domain containing protein 2 antibody
    • MPPED 2 antibody
    see all

Images

  • All lanes : Anti-MPPED2 antibody (ab171781) at 1 µg/ml

    Lane 1 : MPPED2-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution

    Predicted band size: 33 kDa

References

ab171781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up