Overview

  • Product name
  • Description
    Rabbit polyclonal to MPRIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Rat MPRIP aa 771-820 (internal sequence). The exact sequence is proprietary.
    Sequence:

    ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV


    Database link: Q9ERE6

  • Positive control
    • Rat stomach lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 117 kDa.

Target

  • Function
    Targets myosin phosphatase to the actin cytoskeleton. Required for the regulation of the actin cytoskeleton by RhoA and ROCK1. Depletion leads to an increased number of stress fibers in smooth muscle cells through stabilization of actin fibers by phosphorylated myosin. Overexpression of MRIP as well as its F-actin-binding region leads to disassembly of stress fibers in neuronal cells.
  • Sequence similarities
    Contains 2 PH domains.
  • Cellular localization
    Cytoplasm > cytoskeleton. Colocalizes with F-actin.
  • Information by UniProt
  • Database links
  • Alternative names
    • 9530046C02 antibody
    • AA536749 antibody
    • AI647711 antibody
    • C76423 antibody
    • KIAA0864 antibody
    • M-RIP antibody
    • MGC67316 antibody
    • mKIAA0864 antibody
    • Mprip antibody
    • MPRIP_HUMAN antibody
    • Myosin phosphatase Rho-interacting protein antibody
    • p116 Rho-interacting protein antibody
    • p116Rip antibody
    • Rho-interacting protein 3 antibody
    • Rhoip3 antibody
    • RIP3 antibody
    • RP23-180B18.4 antibody
    see all

Images

  • Anti-MPRIP antibody (ab171032) at 1 µg/ml + rat stomach lysate at 10 µg

    Predicted band size: 117 kDa

References

ab171032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up