Anti-TTK/Mps1 antibody (ab24226)
Key features and details
- Rabbit polyclonal to TTK/Mps1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TTK/Mps1 antibody
See all TTK/Mps1 primary antibodies -
Description
Rabbit polyclonal to TTK/Mps1 -
Host species
Rabbit -
Specificity
ab24226 reacts with TTK (Msp1) protein. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Chimpanzee, Ferret, Cynomolgus monkey, Rhesus monkey, Orangutan, Bat -
Immunogen
Synthetic peptide corresponding to Human TTK/Mps1 aa 700-750.
Sequence:DVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ D
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 0.021% PBS, 1.764% Sodium citrate, 1.815% Tris -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antibody was affinity purified using an epitope specific to TTK immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab24226 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2500 - 1/25000. Detects a band of approximately 95 kDa (predicted molecular weight: 95 kDa).
|
Notes |
---|
WB
1/2500 - 1/25000. Detects a band of approximately 95 kDa (predicted molecular weight: 95 kDa). |
Target
-
Function
Phosphorylates proteins on serine, threonine, and tyrosine. Probably associated with cell proliferation. Essential for chromosome alignment by enhancing AURKB activity (via direct CDCA8 phosphorylation) at the centromere, and for the mitotic checkpoint. -
Tissue specificity
Present in rapidly proliferating cell lines. -
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Contains 1 protein kinase domain. - Information by UniProt
-
Database links
- Entrez Gene: 7272 Human
- Omim: 604092 Human
- SwissProt: Q4R945 Cynomolgus monkey
- SwissProt: P33981 Human
- Unigene: 169840 Human
-
Alternative names
- cancer/testis antigen 96 antibody
- CT96 antibody
- Dual specificity protein kinase TTK antibody
see all
Images
-
Detection of Human TTK/Mps1 by Western Blot and Immunoprecipitation.
Samples: Whole cell lysate (15 and 50 µg for A; 50 µg for B; 2 mg for B) from HeLa cells. In B, HeLa cells were treated with an siRNA for vimentin (control) or TTK/Mps1 Ab24226 used at 0.033 (A) and 0.33 (B) µg/ml for WB and at 1 µg/2 mg lysate for IP (C). TTK/Mps1 was also immunoprecipitated with Ab24226 using 1 µg/2 mg lysate. IP reactions were controlled using normal rabbit IgG (control IP). Immunoprecipitated TTK/Mps1 was blotted using a goat antibody directed to an upstream epitope on TTK/Mps1. Detection: Chemiluminescence with exposure times of 1 minute (A), 15 seconds (B) and 30 seconds (C).
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab24226 has not yet been referenced specifically in any publications.