Overview

  • Product name
  • Description
    Rabbit polyclonal to Mps1
  • Host species
    Rabbit
  • Specificity
    ab24226 reacts with TTK (Msp1) protein.
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Chimpanzee, Ferret, Cynomolgus monkey, Rhesus monkey, Orangutan, Bat
  • Immunogen

    Synthetic peptide:

    DVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ D

    , corresponding to amino acids 700 to 750 of Human Mps1

  • Positive control
    • Hela cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab24226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
IP
  • Application notes
    IP: 1-4 µg/mg lysate.
    WB: 1/2500 - 1/25000. Detects a band of approximately 95 kDa (predicted molecular weight: 95 kDa).

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      Phosphorylates proteins on serine, threonine, and tyrosine. Probably associated with cell proliferation. Essential for chromosome alignment by enhancing AURKB activity (via direct CDCA8 phosphorylation) at the centromere, and for the mitotic checkpoint.
    • Tissue specificity
      Present in rapidly proliferating cell lines.
    • Sequence similarities
      Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
      Contains 1 protein kinase domain.
    • Information by UniProt
    • Database links
    • Alternative names
      • cancer/testis antigen 96 antibody
      • CT96 antibody
      • Dual specificity protein kinase TTK antibody
      • ECSTY kinase antibody
      • ESK antibody
      • FLJ38280 antibody
      • hMPS1 antibody
      • Monopolar Spindle 1 Like 1 antibody
      • MPH1 antibody
      • Mps 1 antibody
      • MPS1L1 antibody
      • Phosphotyrosine Picked Threonine Kinase antibody
      • Phosphotyrosine picked threonine-protein kinase antibody
      • PYT antibody
      • RP3-357D13.2 antibody
      • ttk antibody
      • TTK Protein Kinase antibody
      • TTK_HUMAN antibody
      see all

    Images

    • Detection of Human Mps1 by Western Blot and Immunoprecipitation.

      Samples: Whole cell lysate (15 and 50 µg for A; 50 µg for B; 2 mg for B) from HeLa cells. In B, HeLa cells were treated with an siRNA for vimentin (control) or Mps1 Ab24226 used at 0.033 (A) and 0.33 (B) µg/ml for WB and at 1 µg/2 mg lysate for IP (C). Mps1 was also immunoprecipitated with Ab24226 using 1 µg/2 mg lysate. IP reactions were controlled using normal rabbit IgG (control IP). Immunoprecipitated Mps1 was blotted using a goat antibody directed to an upstream epitope on Mps1. Detection: Chemiluminescence with exposure times of 1 minute (A), 15 seconds (B) and 30 seconds (C).

    References

    ab24226 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab24226.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up