Overview

  • Product name
    Anti-MPT64 antibody (Biotin)
    See all MPT64 primary antibodies
  • Description
    Rabbit polyclonal to MPT64 (Biotin)
  • Conjugation
    Biotin
  • Specificity
    Reacts with bacterium.
  • Tested applications
    Suitable for: WBmore details
  • Immunogen

    Recombinant full length protein corresponding to MPT64 aa 24-228. Mycobacterium tuberculosis, UniProt ID's P9WIN8 and P9WIN9
    Sequence:

    APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQT RDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGT HPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQ VSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAI DSMLA

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 25 kDa.

Target

  • Cellular localization
    Secreted
  • Alternative names
    • Antigen MPT64 antibody
    • immunogenic protein antibody
    • immunogenic protein Mpt64 antibody
    • mpb64 antibody
    • MT2032 antibody
    • MTCY39.39 antibody
    • Rv1980c antibody
    • simliar to Rv1980c of M. tuberculosis H37Rv antibody
    see all

References

ab193428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up