Overview

  • Product name
    Anti-mrc1 antibody - N-terminal
  • Description
    Rabbit polyclonal to mrc1 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Schizosaccharomyces pombe
  • Immunogen

    Recombinant fragment corresponding to Schizosaccharomyces pombe mrc1 aa 1-317 (N terminal).
    Sequence:

    MASLDENADELHRMDSSDEASINDDQEDILDTPRTRVRKMLASVDMQLSS NAVSEASLDKESTVGNLENQKNRSYSSEIYLHSDTNFLSNFDSAYERVRR LLNQQGGKSSLQKKEVEQIETQEGGDNAKGSPSSENKDSDRNSRLQQLIE KKRNALKKEQEDLIQNSATSHSKSDNLDSESADDSDLADESELSKKYTSD RKIRNASKKALLELHRNTARLTRETALKPEVVVKKKVTLREFFQKIGFKN DNQLENKAISEEEANSTEPPNVEKEEPKPSVDRSTGIVNSEDIKELSVED DSLELKEITPEALDIGQ


    Database link: Q9P7T4

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituent: 99% Whole serum
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab188269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
WB 1/5000. Predicted molecular weight: 166 kDa.

Images

  • All lanes : Anti-mrc1 antibody - N-terminal (ab188269) at 1/5000 dilution

    Lane 1 : Anti-Mediator of replication checkpoint protein 1 in whole cell extracts of Mediator of replication checkpoint protein 1 - strain
    Lane 2 : Western blot analysis of Anti-Mediator of replication checkpoint protein 1 in whole cell extracts of wild-type strain

    Predicted band size: 166 kDa

References

This product has been referenced in:
  • Fletcher J  et al. Nutrient Limitation Inactivates Mrc1-to-Cds1 Checkpoint Signalling in Schizosaccharomyces pombe. Cells 7:N/A (2018). Read more (PubMed: 29473861) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up