Overview

  • Product nameAnti-MRPL10 antibody
    See all MRPL10 primary antibodies
  • Description
    Rabbit polyclonal to MRPL10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (

    HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE

    ) of Human MRPL10 (NP_660298)

  • Positive control
    • Jurkat Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similaritiesBelongs to the ribosomal protein L10P family.
  • Cellular localizationMitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 39S ribosomal protein L10 antibody
    • 39S ribosomal protein L10 mitochondrial antibody
    • 39S ribosomal protein L10 mitochondrial precursor antibody
    • 39S ribosomal protein L8 antibody
    • L10mt antibody
    • L8mt antibody
    • MGC17973 antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein L10 antibody
    • MRP L10 antibody
    • MRP L8 antibody
    • MRP-L10 antibody
    • MRP-L8 antibody
    • MRPL 10 antibody
    • MRPL10 antibody
    • MRPL8 antibody
    • RM10_HUMAN antibody
    • RPML8 antibody
    see all

Anti-MRPL10 antibody images

  • Anti-MRPL10 antibody (ab84897) at 1 µg/ml + Jurkat Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa

References for Anti-MRPL10 antibody (ab84897)

ab84897 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"