Overview

  • Product name
  • Description
    Rabbit polyclonal to MRPL23
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human MRPL23 aa 1-153. The exact sequence is proprietary. NM_021134.3, NP_066957.3.
    Sequence:

    MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTR VDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLA HGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSW FGL


    Database link: Q16540

Properties

Applications

Our Abpromise guarantee covers the use of ab174791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 18 kDa.

ab174795 was tested in Western blot with recombinant protein; it has not yet shown to detect endogenous MRPL23.

Target

  • Sequence similarities
    Belongs to the ribosomal protein L23P family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • L23MRP antibody
    • 39S ribosomal protein L23 antibody
    • 39S ribosomal protein L23, mitochondrial antibody
    • L23 mitochondrial-related protein antibody
    • L23mt antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein L23 antibody
    • MRP-L23 antibody
    • MRPL23 antibody
    • Ribosomal protein L23-like antibody
    • Ribosomal protein related to L23 (mitochondrial) antibody
    • RM23_HUMAN antibody
    • RPL23 antibody
    • RPL23L antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human tonsil tissue labeling  MRPL23 with ab174791 at 10 µg/ml.

References

ab174791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up