Overview

  • Product name
  • Description
    Rabbit polyclonal to MRPL45
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 256-305 (

    YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL

    ) of Human MRPL45 (NP 115727).

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-MRPL45 antibody (ab113786) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size : 35 kDa

References

This product has been referenced in:
  • Kotani T  et al. Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes. Nucleic Acids Res 41:3713-22 (2013). WB . Read more (PubMed: 23396448) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up