Overview

  • Product nameAnti-MRPL45 antibody
    See all MRPL45 primary antibodies
  • Description
    Rabbit polyclonal to MRPL45
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 256-305 (

    YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL

    ) of Human MRPL45 (NP 115727).

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-MRPL45 antibody images

  • Anti-MRPL45 antibody (ab113786) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size : 35 kDa

References for Anti-MRPL45 antibody (ab113786)

This product has been referenced in:
  • Kotani T  et al. Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes. Nucleic Acids Res 41:3713-22 (2013). WB . Read more (PubMed: 23396448) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab113786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"