Overview

  • Product name
  • Description
    Rabbit polyclonal to MRPL47
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MRPL47 aa 194-250.
    Sequence:

    YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAE AQKSSLV


    Database link: Q9HD33

  • Positive control
    • RT-4 and U-251 MG cell lysates; CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/250 - 1/500. Predicted molecular weight: 29 kDa.

Target

  • Sequence similarities
    Belongs to the ribosomal protein L47em family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 39S ribosomal protein L47 mitochondrial antibody
    • 39S ribosomal protein L47, mitochondrial antibody
    • CGI 204 antibody
    • L47mt antibody
    • MGC45403 antibody
    • Mitochondrial ribosomal protein L47 antibody
    • MRP L47 antibody
    • MRP-L47 antibody
    • MRPL 47 antibody
    • MRPL47 antibody
    • Nasopharyngeal carcinoma metastasis related 1 antibody
    • Nasopharyngeal carcinoma metastasis related protein 1 antibody
    • Nasopharyngeal carcinoma metastasis-related protein 1 antibody
    • NCM1 antibody
    • RM47_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling MRPL47 with ab220005 at 4 µg/mL (green).

  • All lanes : Anti-MRPL47 antibody (ab220005) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 29 kDa

References

ab220005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up