
  • Product nameAnti-MRPL48 antibody
    See all MRPL48 primary antibodies
  • Description
    Rabbit polyclonal to MRPL48
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 71-120 (KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSI K) of Human MRPL48 (NP_057139).

  • Positive control
    • Jurkat cell lysate


Associated products


Our Abpromise guarantee covers the use of ab98163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MRPL48 antibody images

  • Anti-MRPL48 antibody (ab98163) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-MRPL48 antibody (ab98163)

ab98163 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98163.
Please use the links above to contact us or submit feedback about this product.