Overview

  • Product name
  • Description
    Rabbit polyclonal to MRPL55
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MRPL55 aa 34-128.
    Sequence:

    DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDT LSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK


    Database link: Q7Z7F7

  • Positive control
    • WB: K562 and PC3 whole cell lysates. IHC-P: Human heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab194283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 15 kDa.

Target

  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 39S ribosomal protein L55 antibody
    • 39S ribosomal protein L55, mitochondrial antibody
    • AAVG5835 antibody
    • DKFZp686D1387 antibody
    • L55mt antibody
    • L55nt antibody
    • MGC61802 antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein L55 antibody
    • MRP L55 antibody
    • MRP-L55 antibody
    • MRPL55 antibody
    • PRO19675 antibody
    • RM55_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human heart tissue labelling MRPL55 with ab194283 at a dilution of 1/100.

  • All lanes : Anti-MRPL55 antibody (ab194283) at 2 µg/ml

    Lane 1 : K562 whole cell lysate
    Lane 2 : PC-3 whole cell lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 15 kDa
    Observed band size: 16 kDa (why is the actual band size different from the predicted?)

References

ab194283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up