
  • Product nameAnti-MRPS6 antibody
    See all MRPS6 primary antibodies
  • Description
    Rabbit polyclonal to MRPS6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 75-124 (VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKR K) of Human MRPS6 (NP_115865).

  • Positive control
    • Jurkat Cell Lysate.



Our Abpromise guarantee covers the use of ab106588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MRPS6 antibody images

  • Anti-MRPS6 antibody (ab106588) at 1 µg/ml + 10 µg Jurkat Cell lysate

    Predicted band size : 14 kDa

References for Anti-MRPS6 antibody (ab106588)

ab106588 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106588.
Please use the links above to contact us or submit feedback about this product.