Overview

  • Product name
    Anti-MRRF antibody [AT7D10]
    See all MRRF primary antibodies
  • Description
    Mouse monoclonal [AT7D10] to MRRF
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human MRRF aa 56-262. Isoform 1, expressed in E.coli.
    Sequence:

    MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAV PVRHFATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALK DNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMAS FPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQN TNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELD RHLAVKTKELLG


    Database link: Q96E11

  • Positive control
    • HepG2, 293T or HeLa lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.01% Sodium azide
    Constituents: 10% Glycerol, 89% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT7D10
  • Isotype
    IgG1
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 29 kDa.

Target

Images

  • All lanes : Anti-MRRF antibody [AT7D10] (ab171621) at 1/1000 dilution

    Lane 1 : HepG2 lysate
    Lane 2 : 293T lysate
    Lane 3 : HeLa lysate

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 29 kDa

References

ab171621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up