Overview

  • Product nameAnti-MS4A14 antibody
    See all MS4A14 primary antibodies
  • Description
    Rabbit polyclonal to MS4A14
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 576 - 625 (

    YPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNVQ

    ) of Human MS4A14 (NP_115986)

  • Positive control
    • PANC1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 77 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceMS4A14 may be involved in signal transduction as a component of a multimeric receptor complex.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • FLJ32856 antibody
    • Membrane spanning 4 domains subfamily A member 14 antibody
    • Membrane spanning 4 domains subfamily A member 16 antibody
    • MGC104289 antibody
    • MGC49828 antibody
    • MS4A13 antibody
    • MS4A13 protein antibody
    • MS4A16 antibody
    • NYD SP21 antibody
    • NYDSP21 antibody
    • Testis development protein NYD SP21 antibody
    • Testis development protein NYDSP21 antibody
    • Testis development related NYD SP21 antibody
    • Testis development related NYDSP21 antibody
    see all

Anti-MS4A14 antibody images

  • Anti-MS4A14 antibody (ab90010) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 77 kDa

References for Anti-MS4A14 antibody (ab90010)

ab90010 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"