Overview

  • Product name
    Anti-Msx3 antibody - C-terminal
  • Description
    Rabbit polyclonal to Msx3 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Rat Msx3 aa 151-200 (C terminal). The exact sequence is proprietary.
    Sequence:

    EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM


    Database link: NP_446164

  • Positive control
    • Rat lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab170974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Relevance
    Acts as a potent transcriptional repressor of MSX1 Interacts with CREBBP/CBP, NOTCH1/p300 and HDAC1. Appears to exist in two distinct complexes in the cell, one which includes CREBBP and NOTCH1 and the other which contains HDAC1. Belongs to the Msh homeobox family. Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus
  • Database links
  • Alternative names
    • AI323377 antibody
    • homeo box, msh-like 3 antibody
    • homeobox protein MSX-3 antibody
    • Msx3 antibody

Images

  • Anti-Msx3 antibody - C-terminal (ab170974) at 1 µg/ml + Rat lung lysate at 10 µg

    Predicted band size: 22 kDa

References

ab170974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up