Anti-MTA3 antibody (ab87275)
Key features and details
- Rabbit polyclonal to MTA3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MTA3 antibody
See all MTA3 primary antibodies -
Description
Rabbit polyclonal to MTA3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Rhesus monkey, Orangutan -
Immunogen
Synthetic peptide corresponding to a region within the internal sequence amino acids 400-450 (
CRLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQG M
) of Human MTA3 (Swiss-Prot entry Q9BTC8, GeneID 57504) -
General notes
Concentration is optimized for IHC and not determined
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
MTA3 antibody was affinity purified using an epitope specific to MTA3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab87275 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/100 - 1/500. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. |
Target
-
Function
Plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels. -
Tissue specificity
No expression in nonepithelial cells. -
Sequence similarities
Contains 1 BAH domain.
Contains 1 ELM2 domain.
Contains 1 GATA-type zinc finger.
Contains 1 SANT domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 57504 Human
- Omim: 609050 Human
- SwissProt: Q9BTC8 Human
- Unigene: 435413 Human
-
Alternative names
- 1110002J22Rik antibody
- fj99h01 antibody
- KIAA1266 antibody
see all
Images
-
ab87275 at 1/250 dilution staining MTA3 in Human breast carcinoma by Immunohistochemistry Formalin-fixed, Paraffin-embedded tissue. Detection: DAB staining
-
ab87275 at 1/250 dilution staining MTA3 in Human seminoma by Immunohistochemistry Formalin-fixed, Paraffin-embedded tissue. Detection: DAB staining
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab87275 has been referenced in 5 publications.
- Qian W et al. Metastasis-associated protein 1 promotes epithelial-mesenchymal transition in idiopathic pulmonary fibrosis by up-regulating Snail expression. J Cell Mol Med 24:5998-6007 (2020). PubMed: 32187849
- Paget S et al. HIC1 (hypermethylated in cancer 1) SUMOylation is dispensable for DNA repair but is essential for the apoptotic DNA damage response (DDR) to irreparable DNA double-strand breaks (DSBs). Oncotarget 8:2916-2935 (2017). WB . PubMed: 27935866
- Chen Y et al. MTA3 Regulates Extravillous Trophoblast Invasion Through NuRD Complex. AIMS Med Sci 4:17-27 (2017). PubMed: 28959722
- Dubuissez M et al. Protein Kinase C-Mediated Phosphorylation of BCL11B at Serine 2 Negatively Regulates Its Interaction with NuRD Complexes during CD4+ T-Cell Activation. Mol Cell Biol 36:1881-98 (2016). PubMed: 27161321
- Zhang X et al. ß-elemene decreases cell invasion by upregulating E-cadherin expression in MCF-7 human breast cancer cells. Oncol Rep 30:745-50 (2013). Human . PubMed: 23732279