Overview

  • Product nameAnti-MTCO3 antibody
    See all MTCO3 primary antibodies
  • Description
    Rabbit polyclonal to MTCO3
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 181-230 (FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSK H) of Human Cytochrome C Oxidase subunit III, NP_536849

  • Positive control
    • 721_B cell lysate.

Applications

Our Abpromise guarantee covers the use of ab81180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

  • FunctionSubunits I, II and III form the functional core of the enzyme complex.
  • Involvement in diseaseDefects in MT-CO3 are a cause of Leber hereditary optic neuropathy (LHON) [MIM:535000]. LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
    Defects in MT-CO3 are a cause of mitochondrial complex IV deficiency (MT-C4D) [MIM:220110]; also known as cytochrome c oxidase deficiency. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs. Features include hypertrophic cardiomyopathy, hepatomegaly and liver dysfunction, hypotonia, muscle weakness, excercise intolerance, developmental delay, delayed motor development and mental retardation. A subset of patients manifest Leigh syndrome.
    Defects in MT-CO3 are associated with recurrent myoglobinuria mitochondrial (RM-MT) [MIM:550500]. Recurrent myoglobinuria is characterized by recurrent attacks of rhabdomyolysis (necrosis or disintegration of skeletal muscle) associated with muscle pain and weakness, and followed by excretion of myoglobin in the urine.
  • Sequence similaritiesBelongs to the cytochrome c oxidase subunit 3 family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • COIII antibody
    • COX3 antibody
    • COX3_HUMAN antibody
    • COXIII antibody
    • Cytochrome c oxidase polypeptide III antibody
    • Cytochrome c oxidase subunit 3 antibody
    • MT CO3 antibody
    • MT-CO3 antibody
    • MTCO3 antibody
    see all

Anti-MTCO3 antibody images

  • Anti-MTCO3 antibody (ab81180) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa
    Observed band size : 30 kDa
    Additional bands at : 40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-MTCO3 antibody (ab81180)

ab81180 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Sample Human Cell lysate - other (HeLa WT vs HeLa rho-0)
Loading amount 13 µg
Specification HeLa WT vs HeLa rho-0
Gel Running Conditions Reduced Denaturing (Reduced Denaturing (4-15%))
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Username

Abcam user community

Verified customer

Submitted Jul 27 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"