
  • Product name
  • Description
    Rabbit polyclonal to MTHFD2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 179-228 (VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATV T) of Human MTHFD2, NP_006627

  • Positive control
    • Transfected 293T cell lysate



Our Abpromise guarantee covers the use of ab86324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MTHFD2 antibody images

  • Anti-MTHFD2 antibody (ab86324) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 38 kDa

References for Anti-MTHFD2 antibody (ab86324)

ab86324 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86324.
Please use the links above to contact us or submit feedback about this product.


Sign up