Overview

  • Product nameAnti-MTMR12 antibody
    See all MTMR12 primary antibodies
  • Description
    Rabbit polyclonal to MTMR12
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 540 - 589 (

    LYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKN

    ) of Human MTMR12 (NP_001035536)

  • Positive control
    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalytically inactive phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.
  • Tissue specificityUbiquitous with prominent expression in brain, heart, kidney, placenta, and lung.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily.
    Contains 1 myotubularin phosphatase domain.
  • Cellular localizationCytoplasm. Localizes to punctate vesicles when associated with MTM1.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3 PAP antibody
    • 3 phosphatase adapter protein antibody
    • 3 phosphatase adapter subunit antibody
    • 3-PAP antibody
    • 3-phosphatase adapter protein antibody
    • 3PAP antibody
    • KIAA1682 antibody
    • Mtmr12 antibody
    • MTMRC_HUMAN antibody
    • Myotubularin related protein 12 antibody
    • Myotubularin-related protein 12 antibody
    • Phosphatidylinositol 3 phosphate 3 phosphatase adapter subunit antibody
    • Phosphatidylinositol 3 phosphate 3-phosphatase adapter subunit antibody
    • Phosphatidylinositol 3 phosphate associated protein antibody
    • PIP3AP antibody
    see all

Anti-MTMR12 antibody images

  • Anti-MTMR12 antibody (ab94444) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 86 kDa

References for Anti-MTMR12 antibody (ab94444)

ab94444 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"