Anti-mtRNA polymerase antibody - C-terminal (ab179721)

Overview

  • Product name
    Anti-mtRNA polymerase antibody - C-terminal
    See all mtRNA polymerase primary antibodies
  • Description
    Rabbit polyclonal to mtRNA polymerase - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human mtRNA polymerase aa 933-982 (C terminal). The exact sequence is proprietary. (NP_005026)
    Sequence:

    ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE


    Database link: O00411

  • Positive control
    • OVCAR-3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 139 kDa.

Target

  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates.
  • Sequence similarities
    Belongs to the phage and mitochondrial RNA polymerase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • APOLMT antibody
    • DNA-directed RNA polymerase antibody
    • DNA-directed RNA polymerase mitochondrial antibody
    • h-mtRPOL antibody
    • mitochondrial antibody
    • MTRNAP antibody
    • MtRPOL antibody
    • POLRMT antibody
    • polymerase (RNA) mitochondrial (DNA directed) antibody
    • polymerase, RNA, mitochondrial antibody
    • RPOM antibody
    • RPOM_HUMAN antibody
    see all

Images

  • Anti-mtRNA polymerase antibody - C-terminal (ab179721) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size : 139 kDa

References

ab179721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up